PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009760062.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 213aa    MW: 25264.6 Da    PI: 9.5987
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009760062.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF56.34e-18347549
                    SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  5 nksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    n+ +r+v +  R ++++KKAeELSvLCd+e+ +i+fs++ +  ey
  XP_009760062.1  3 NEHRRSVVLQERMETLFKKAEELSVLCDVEIGIIVFSPDERNAEY 47
                    889**********************************99776554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.9E-6150IPR002100Transcription factor, MADS-box
PROSITE profilePS5006615.152151IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.67E-17283IPR002100Transcription factor, MADS-box
PfamPF003193.7E-15343IPR002100Transcription factor, MADS-box
CDDcd001202.49E-15351No hitNo description
PRINTSPR004041.0E-61328IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-62849IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MVNEHRRSVV LQERMETLFK KAEELSVLCD VEIGIIVFSP DERNAEYEWP SRDKFKQLMM  60
RYLDKPLLER LKKLTTNEMF LRKEMDAKMK KIDQQKTEEK EMEQIFSQLY LGEKTIFDLD  120
KRQLIGVRNL AIKAKEKAVK RRIQLKYLQD QRLSLPFDRI LIRVAPLNVQ DQRLQLSVDD  180
PLALRLAPLN VHDQRLQLPV DDPLALRLAP PEN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009760062.11e-152PREDICTED: MADS-box transcription factor 31-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37820129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05860.23e-13M-type_MADS family protein